SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8PNB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8PNB4
Domain Number - Region: 186-216
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00889
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8PNB4
Sequence length 224
Comment (tr|B8PNB4|B8PNB4_POSPM) Predicted protein {ECO:0000313|EMBL:EED77632.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_26251 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
VQVALSLLDGNAHTWATLIFSQLSSVMIGMQGAVAPFATLKDFLTAFKSRFGNLDNAATA
QVELTKLCGNKCLHEKCPTAEFSTLFKGLADCSGYGDLELRDKYLSGIPSHIYRKIELET
FTTWKAADKRAMEVKQILDISWAHCPELNNFFSARGGGRGGARGGAPRSQGASASINAAV
GKGDFPGSCFGCGKQGYCRFECPNCKDKPYTKCADTRAMVALGS
Download sequence
Identical sequences B8PNB4
104341.JGI26251 XP_002477169.1.31404 jgi|Pospl1|26251|gw1.349.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]