SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8PPK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8PPK8
Domain Number 1 Region: 186-215
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000244
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8PPK8
Sequence length 218
Comment (tr|B8PPK8|B8PPK8_POSPM) Predicted protein {ECO:0000313|EMBL:EED77188.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_95445 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MRKDLGKTWADAYYEKSAGGVQVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKN
KKTVLSLGNYVTRFEQLASKAQLKDAEVNGVNCTENDYHTLHANFVKGLPKELYVSLATR
VARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWE
LGAVLNEADRKLHRDRNLCFYCHIKGHSTKDCRKKAAA
Download sequence
Identical sequences B8PPK8
104341.JGI95445 jgi|Pospl1|95445|fgenesh3_pg.1137__1 XP_002477613.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]