SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8Y9T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8Y9T0
Domain Number 1 Region: 1817-1984
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-27
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 2 Region: 1451-1623
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-27
Family Fibronectin type III 0.00000952
Further Details:      
 
Domain Number 3 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-25
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 4 Region: 1635-1807
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-25
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 727-892
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 1266-1440
Classification Level Classification E-value
Superfamily Fibronectin type III 6.45e-22
Family Fibronectin type III 0.0000106
Further Details:      
 
Domain Number 7 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-21
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 9 Region: 1174-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 4.07e-17
Family Fibronectin type III 0.0000028
Further Details:      
 
Domain Number 10 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000903
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 11 Region: 2131-2174
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000157
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000275
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 13 Region: 619-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000394
Family Fibronectin type III 0.00000621
Further Details:      
 
Domain Number 14 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000107
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 15 Region: 468-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000144
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 16 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 2086-2129
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000733
Family Fibronectin type I module 0.0035
Further Details:      
 
Domain Number 18 Region: 185-230
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000785
Family Fibronectin type I module 0.00016
Further Details:      
 
Domain Number 19 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000157
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000327
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2174-2215
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000164
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000011
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 23 Region: 2001-2063
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000369
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 24 Region: 1097-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000951
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8Y9T0
Sequence length 2268
Comment (tr|B8Y9T0|B8Y9T0_BOVIN) Fibronectin {ECO:0000313|Ensembl:ENSBTAP00000010926} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=FN1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLGGPGPGLLLLLAVLSLGTAVPSAGASKSRRQAQQIVQPQSPLTVSQSKPGCYDNGKHY
QINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDVRTAIYQPQPH
PQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGKTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWAC
QPLQTYPDTSGPVQVIITETPSQPNSHPIQWSAPESSHISKYILRWKPKNSPNRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGQREVTRFDFTTTSTSPAVTSNTVTGETTPLS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYTVNVYEISEEGEQNLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPRAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKITIMWTPPESPVTGYRVDVIPVNLPGEHGQRLPVSRN
TFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQQATKLDAPTNLQFINETDTTVIVTWTP
PRARIVGYRLTVGLTRGGQPKQYNVGPAASQYPLRNLQPGSEYAVSLVAVKGNQQSPRVT
GVFTTLQPLGSIPHYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIV
VSGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPI
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWA
PPSSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESI
PLRGRQKTALDSPSGIDFSDITANSFTVHWIAPRATITGYRIRHHPENMGGRPREDRVPP
SRNSITLTNLNPGTEYVVSIVALNSKEESLPLVGQQSTVSDVPRDLEVIAATPTSLLISW
DAPAVTVRYYRITYGETGGSSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP
ASSKPVSINYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTAPKNGPGPSKTK
TVGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTTIPAPTNLKFTQVTPTSL
TAQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDT
LTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPIQ
RTIRPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNS
LLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIQVIALKN
NQKSEPLIGRKKTGQEALSQTTISWTPFQESSEYIISCHPVGIDEEPLQFRVPGTSASAT
LTGLTRGATYNIIVEAVKDQQRQKVREEVVTVGNSVDQGLSQPTDDSCFDPYTVSHYAIG
EEWERLSDSGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTC
LGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGA
EPGNEGSTAHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences B8Y9T0
ENSBTAP00000010926 XP_005202841.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]