SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9DYC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9DYC4
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.71e-37
Family Ribosomal protein L6 0.000031
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.52e-25
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9DYC4
Sequence length 180
Comment (sp|B9DYC4|RL6_CLOK1) 50S ribosomal protein L6 {ECO:0000255|HAMAP-Rule:MF_01365} KW=Complete proteome OX=583346 OS=Clostridium kluyveri (strain NBRC 12016). GN=CKR_0198; OC=Clostridium.
Sequence
MSRIGKLPIAIPAGVTFTVTPDNVVTVKGSKGQLVKAMAKDINIAVEDNSVVVTRNDDEK
KSRSLHGLTRALINNMVVGVTEGYSKTLELIGVGYRAQLQGKKLVMNLGFSHPVEIEAVE
GVTFETPAATKVVIKGIDKELVGNVAADIRSWRKPEPYKGKGIKYDNEVIRRKEGKTGKK
Download sequence
Identical sequences A5N4R2 B9DYC4
WP_011988818.1.77168 WP_011988818.1.89246 gi|153952876|ref|YP_001393641.1| 431943.CKL_0239 583346.CKR_0198 gi|219853541|ref|YP_002470663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]