SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9EKV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9EKV4
Domain Number 1 Region: 30-514
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-170
Family ALDH-like 0.00000000000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9EKV4
Sequence length 518
Comment (tr|B9EKV4|B9EKV4_HUMAN) Aldehyde dehydrogenase 9 family, member A1 {ECO:0000313|EMBL:AAI51141.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_21745 OC=Catarrhini; Hominidae; Homo.
Sequence
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMEC
INNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
Download sequence
Identical sequences B9EKV4
ENSP00000346827 ENSP00000346827 gi|115387104|ref|NP_000687.3| 9606.ENSP00000346827 NP_000687.3.87134 NP_000687.3.92137 ENSP00000346827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]