SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9H228 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9H228
Domain Number 1 Region: 360-462
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9H228
Sequence length 918
Comment (tr|B9H228|B9H228_POPTR) Uncharacterized protein {ECO:0000313|EMBL:EEE85512.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0004s03530g OC=Populus.
Sequence
MSSSPPHLPTSTTATTANNNNTSCSSSSTALSRKCFNSDCTDFKSRKGWRLRSGDFAELC
DRCASAYEEGSFCETFHLRASGWRCCESCGKGVHCGCIVSIQTFTLLDAGGIACMACERK
SFVLESNPQILLTATSADVTSNPAWSPLFYHAPFPERLKDLSVKSWSQLAGSGPVPWRQA
PSLFNPSAAQSELQTRMPYEVDRLNTGERFSAPSLEKRKVEDFSEKFINGNLRIRLQDIV
ENGNAGIIGEEQPQPSSSLMEDASGQQFGITIPYKSISESNSQIEGSVNALQPAPPPPFT
KHFHGSLHNGVDSSVDGHIRNGKPRTDARGRSQLLPRYWPRFTDGELQQISGNSNSVIKP
LFEKMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLRVQDSKGKEWIFQFRFWPNNN
SRMYVLEGVTPCIQNMQLQAGDIVTFSRLEPEGKLVMGFRKATSAPPSDQDNETSQTGNG
VSTKGDAELDPSPWSKVDKSGYIAKEVLEGKSSIRKRKSSTLGSKSKRLRIENEDMIELK
LTWEEAQGLLRPPPDHVPSIVAIEGFEFEEYEDAPVLGKPTIFATDNVGQKIQWVQCEDC
LKWRKLPANALLPSKWACSSNTWDPERSSCSVAQELTAEQLEDLLPSCNLVVTSKRSKDA
KKDIDRVEALEGLDTLANLAILGEGEAFPASSQATTKHPRHRPGCSCIVCIQPPSGKGPK
HKQTCTCNVCQTVKRRFKTLMMKREKKQSEKEAETKQSEKEAETTRKRQQEPSAEKLLDD
EPSPSSNTGSESGSPNKKKTVSEGSDDDPSRMKSSTSPFKGQIDLNIQPEREDELSPGSD
SGGMMRMLQDATETYLRMQRFLSSDGDNNPSGNHMLSSGGTREKVSDVIMLGSSHQDADK
DHPSAFSMNASASTPATG
Download sequence
Identical sequences B9H228
XP_002305001.1.11743 3694.eugene3.00040219 POPTR_0004s03530.1|PACid:18225369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]