SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9JIP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9JIP3
Domain Number 1 Region: 123-380
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.02e-50
Family D-glucarate dehydratase-like 0.00000000593
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.18e-26
Family Enolase N-terminal domain-like 0.000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9JIP3
Sequence length 387
Comment (tr|B9JIP3|B9JIP3_AGRRK) Uncharacterized protein {ECO:0000313|EMBL:ACM29785.1} KW=Complete proteome; Reference proteome OX=311403 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868). GN=Arad_8540 OC=Agrobacterium tumefaciens complex.
Sequence
MRILDICEVTKPIASPIRNAYIDFSKMTASLVAIVTDVVRDGRRVVGYGFNSNGRYGQGG
LIRERFKDRILEASPESLMNDAGTNLDPHKIWATMMMNEKPGGHGERSVAVGTLDMAIWD
AVAKIEGKPLFRHLAELKGREANPKVFVYAAGGYYYPGKDNSALRKEMRSYLDRGYNVVK
MKIGGASIDEDRGRIESVLEEIGSQARLAVDANGRFDLETGIAYAKMLRDYPLFWYEEIG
DPLDYALQAAISEFYDAPMATGENLFSHQDARNLLRYGGMRADRDFLQFDCALSYGLVEY
LRTLDVLHQFGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVNVIDG
HITMPELPGIGFEGKSDLIKVMRELAE
Download sequence
Identical sequences B9JIP3
WP_012650058.1.91008 gi|222082017|ref|YP_002541382.1| 311403.Arad_8540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]