SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9JQ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9JQ23
Domain Number 1 Region: 130-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-60
Family D-glucarate dehydratase-like 0.000000902
Further Details:      
 
Domain Number 2 Region: 5-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.41e-33
Family Enolase N-terminal domain-like 0.00000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9JQ23
Sequence length 383
Comment (tr|B9JQ23|B9JQ23_AGRRK) Mandelate racemase/muconate lactonizing enzyme {ECO:0000313|EMBL:ACM31242.1} KW=Complete proteome; Reference proteome OX=311403 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868). GN=Arad_12213 OC=Agrobacterium tumefaciens complex.
Sequence
MSGIIRITAIETIILDLPTIRPHKLSMVTMSQQSMTIVRIRCSDDFEGTGEGTTIGGLAY
GPESPEGMKLTIDQYVAPLLIGRDATRVQAAMDIVSKAIKGNHFAKCAVETALLDCHARR
LGLPLSELLGGRRRDSLPIAWTLASGDTARDVDEAQQMLDLRRHKDFKLKIGSKPIAEDV
RHVADIRKALPDTASIRVDVNMAWREREAKGAIDALADAGCVLVEQPVAGIAPLARLTRA
SSIAIMADEALVGPESALEAATARAADVFSIKIEQAGGLFAAAKVIAIAETAGISIYGGT
MLEGPVGTIAASQLLVGVTDLPWGTEFFGPLLLTEELLIEPLVFRDFELQIPTGPGLGIT
LDESAVDRFRRGAKPAGGLRIAG
Download sequence
Identical sequences B9JQ23
gi|222102116|ref|YP_002546706.1| WP_012653236.1.91008 311403.Arad_12213 gi|222102116|ref|YP_002546706.1|NC_011987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]