SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9KVT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9KVT1
Domain Number 1 Region: 704-901
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 
Domain Number 2 Region: 24-229
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.039
Further Details:      
 
Domain Number 3 Region: 425-530
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000252
Family Pyruvate oxidase and decarboxylase PP module 0.082
Further Details:      
 
Weak hits

Sequence:  B9KVT1
Domain Number - Region: 279-363
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0243
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9KVT1
Sequence length 1119
Comment (tr|B9KVT1|B9KVT1_RHOSK) Pyruvate ferredoxin/flavodoxin oxidoreductase {ECO:0000313|EMBL:ACM04159.1} KW=Complete proteome OX=557760 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085). GN=RSKD131_4299 OC=Rhodobacteraceae; Rhodobacter.
Sequence
MTLHTRPEAPAPALTDRYTQASGRILASGAQALARLMIEQQRRDRADGLDTAGYVTGYRG
SPLADFDGELMRAGRFLSASAIRFQPGLNEDLAATAVWGSQQIDLSPGARHDGVFALWYG
KGPGVDRSMDAIRHANAAGTHPRGGVLLLMGDDHGAVSSTFPHQSEQVLISAMVPILSPA
GVEEYIDFGLAGFALSRFAGVWVGFKCQTDIVECTRSIDLPDPAARPALPDMTLPPGGLS
IRWPDDKLAQEARLEVKMEAVRAFAAANGLDRILGAGAGARRGIVATGKAWRDLTGAFAR
AGISPEEAGLRLLKVGLVWPLVPATLDRFAEGLEEILVIEEKRPVIEDQIRAQFYNRTGA
RPRIWGKTTPEGAPLISSTAELDPAGLVPVLAAFLRLPPIPLPEAPAPAPGLPFREPYFC
SGCPHSVSTKLPDGSRATAGIGCSMLAVAMDRNVETFTQMGGEGANWIGHAPFTDERHVF
VHMGDGTYFHSGLLAIRAAVAAGVNATYKILFNDAVAMTGGQTHDGSLTVPAAVDQIRAE
GVRELVVIAEEPAQWQGRLPAGVKVLHRDRLQAEQIRLREVEGVTCIIYDQVCAAEKRRR
RKRGSHPKPAAQVMIHPGVCEGCGDCSVQSNCIAIEPLETDLGRKRQVNLSACNADLSCL
KGFCPSFVTIEGGQRRPQLAPLPEALGHDLPPPAAAPAGPAQALLLAGIGGTGVITVSAI
LAQAAHLDGLAVQVLNQTGLAQKNGAVMAHLRFATDARALHAPRIGLAEADAVLAFDSVA
AAAPKGLACIDPGRTRVVADRHVTPTAGFVRHSTAPREDMQAMDQLRSRARARLETVPAT
ELALHHFGDAIAANILLTGHAFQLGLIPLSEGAILQAIRMNGGAAERNLEAFRAGRLLAA
RPEAFAPAPPAAEPTVAELRDRLVRHLTEWQDTPYAARFERLMDRAAARVQGWTGGEAFL
RALMRGTHHVMAFKDEYEVARLHLDPSFHASVAREFEGDYRLAYHLSPPFPGRADARTGR
PAKLRFGPWMQHGFRLLARMKRLRGTPFDPFGQSSERRAERALRERYIRRMEDRIAALTP
EDLPAATQEAEAVLAVRGFGPVKARNLARWQAEWGDARA
Download sequence
Identical sequences B9KVT1
WP_015923219.1.19875 557760.RSKD131_4299 gi|221370136|ref|YP_002521232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]