SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9L4D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9L4D9
Domain Number - Region: 108-146
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.017
Family Phase 1 flagellin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9L4D9
Sequence length 151
Comment (tr|B9L4D9|B9L4D9_THERP) Flagellar basal-body rod protein FlgC {ECO:0000256|RuleBase:RU362062} KW=Complete proteome; Reference proteome OX=309801 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2). GN=trd_A0653 OC=Thermomicrobium.
Sequence
MGILETMRVSLSALTAQRVRMDVTASNLANVDTTRTPQGGPYLRRQVVFATEQPSPFARL
VQTRTGLVETTPSAGRGVQVAGIVVDRRAVREVYDPTHPDADANGIVRYPDIDVVSEMTN
LMAATRAYEANVTVLDALKTMAMRALSIGRA
Download sequence
Identical sequences B9L4D9
gi|221636059|ref|YP_002523935.1| 309801.trd_A0653 WP_012643165.1.69661 gi|221636059|ref|YP_002523935.1|NC_011961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]