SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9LW92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9LW92
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Transposase IS200-like 2.09e-39
Family Transposase IS200-like 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9LW92
Sequence length 129
Comment (tr|B9LW92|B9LW92_HALLT) Transposase IS200-family protein {ECO:0000313|EMBL:ACM58482.1} KW=Complete proteome; Reference proteome OX=416348 OS=ACAM 34). GN=Hlac_2929 OC=Halorubrum.
Sequence
MKTTRHATYNLNYHLVWLPKYRNSVLVNEVADRVRTILHEIADDKGLEILDLTVQPDHVH
LFVSSPPKHAPSLLANWFKGISSRKYNHRYADHDGEKIGWVRGYYAGTAGHVSSETVKNY
IQRHEEDES
Download sequence
Identical sequences B9LW92
WP_012660096.1.44229 WP_012660096.1.66911 WP_012660096.1.80915 416348.Hlac_2929 416348.Hlac_3365 gi|222481246|ref|YP_002567482.1|NC_012030 gi|222475847|ref|YP_002564368.1| gi|222481246|ref|YP_002567482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]