SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9M1H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9M1H4
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000209
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9M1H4
Sequence length 152
Comment (tr|B9M1H4|B9M1H4_GEODF) Uncharacterized protein {ECO:0000313|EMBL:ACM21056.1} KW=Complete proteome; Reference proteome OX=316067 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32). GN=Geob_2706 OC=Geobacteraceae; Geobacter.
Sequence
MNILWWHWLVLGLVLIGLELVVPSFTIIWFGLGAILVSIFLAIYPTFSLPLQILTWSVAS
IVFTFVWFRFFNPRTSKTFSGSAKGTVLGETGLVIRGAEPYTKGTVKFQLPLLGADEWPC
MADEPLEIGDRVKVVNVEGHVMKVTKLKKGES
Download sequence
Identical sequences B9M1H4
WP_012647784.1.88144 gi|222055795|ref|YP_002538157.1| 316067.Geob_2706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]