SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9RMR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9RMR5
Domain Number - Region: 57-188
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.00445
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9RMR5
Sequence length 195
Comment (tr|B9RMR5|B9RMR5_RICCO) Photosystem II core complex proteins psbY, chloroplast {ECO:0000313|EMBL:EEF47588.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_1082890 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MATMAILNTKCLSNINSGKNINKPTTTKPISLLSMQELPKGLTISKPTNENKLLAGTAIA
GAIFSTLSSCDPAFAAQQIAEIAEGDNRGLALLLPIIPALGWVLFNILRPALNQINRMRE
TKGVIIGLGLGGLAATGFMAAAPEASASENIAMIADAASDNRGQLLLFVVAPAILWVLYN
ILQPALNQINRMRSE
Download sequence
Identical sequences B9RMR5
29929.m004770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]