SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0NU24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0NU24
Domain Number 1 Region: 532-742
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.41e-65
Family Pyruvate oxidase and decarboxylase PP module 0.000000228
Further Details:      
 
Domain Number 2 Region: 352-525
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.4e-61
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000111
Further Details:      
 
Domain Number 3 Region: 155-328
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.38e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0NU24
Sequence length 751
Comment (tr|C0NU24|C0NU24_AJECG) Acetolactate synthase {ECO:0000256|RuleBase:RU003591} KW=Complete proteome; Reference proteome OX=447093 OS=2432) (Darling's disease fungus) (Histoplasma capsulatum). GN=HCBG_06855 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MTVQHPDNGKTCPLNPTRLFQFPRPFLSATWNLFSKFSSYPDLAGPGLSPLTKMMSIRLS
RRALCALHAQKASSLNCSRPFSSSAATASISSQSRLSQRSSAREVPKRDQSTVSAPSPHA
RPYPSPAFNQYTPQNDISPLQNQNIPAVDESFIGMSGGEIFHEMMLRQGVKHIFGYPGGA
ILPVFDAIYNSKNLDFILPRHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVITPIQDA
MSDGTPMVVFCGQVATTAIGTDAFQEADVIGISRACTKWNVMVKSVAELPRRIKEAFEIA
TSGRPGPVLVDLPKDVTASILQKPIPMSSTLPTQPSAATLAARELNARYLDANIQLAAKL
INIAKKPVLYVGQGLLARPEGPELLKQLADKANIPVTTTLQGLGGFDEMDPKSLHMLGMH
GSAYANMAMQEADLIIAMGARFDDRVTGNISKFAPQAKAAASENRGGIIHFEMVPKNINK
VVEATIPVEGDCADNLARLLPQIKAIKERPEWFAQINDWKKRFPLSLYERQTPEGLIKPQ
ALIEKLNELTAHMKDRTVVTTGVGQHQMWAAQHFRWRYPRTMITSGGLGTMGYGLPSAIG
AKVARPDALVIDIDGDASFNMTITELSTAAQFNIGVKIIVLNNEEQGMVTQWQSLFYEDR
FAHTHQLNPDFVKVSEAMGVQARLCSKPNDVESSLKWLIESEGPALLEVTTDKKVPVLPM
VPTGKGLHEFLVYDEAKEKERRAIMKQRSGH
Download sequence
Identical sequences C0NU24
HCBG_06855T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]