SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0QKG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0QKG0
Domain Number 1 Region: 232-273,306-334,427-629
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.09e-44
Family CoA transferase alpha subunit-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0QKG0
Sequence length 724
Comment (tr|C0QKG0|C0QKG0_DESAH) Putative acetyl-CoA hydrolase (Acetyl-CoA hydrolase/transferase family protein) {ECO:0000313|EMBL:ACN14031.1} KW=Complete proteome; Reference proteome OX=177437 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2). GN=HRM2_09180 OC=Desulfobacteraceae; Desulfobacterium.
Sequence
MSKKQPVYFTDVEQCVDDLIGQVGKEIILAAPLALAKPTQLINAIYRRLKTDPELHFTLV
TAVALEKPTWSSELEHRFLGPLVERIWGGFIDFDYVLDMRKGQIPPNFELVEFFNKAGGW
MTNAHAAQNYLGSNYTHAVRDAVINRCNVLSQLVAKQEINGKILFSMSSNPDTHLEGAKV
MRDMRAKGEKVAIIAQVNTNLPFMYGKAVVEPGFYDMVIDSPDLDFTLFGAPKEPINNVD
WMIGLHASTLVRDGGTIQVGIGSLGDAIVAGLDMRHRENKAYCDFLTQADILSKFNPLIQ
TIGGTDVFKTGLLGSSEMFVDSLLELIKAGIIKRKVYEDVRLQKLLNQKRFEDTQIEDIF
REFVAQRMLHPVIKESEVGFLKHFGIFHPDVTYVDRSIRLGQTEYSLDMRIAKNVEAVAL
NCLGPCLKNGVVLYASFFIGPQAFYTELREMDDDQLKLIDMRGVDYVNQLYGNEALKRLQ
RVHGRFINAGIMVTLSGAVCAGGLEDNKIISGPGGQYNFVAMAHALDDGRAVTMIRSTRE
AGSKTTSNVVWQYGHITIPRHLRDIVVTEYGIADLRGARDREAMTRLICIADSRFQEELL
DKAKAAGKIPRDWQIPEPFTNNTPQALEEKLAAFRKKGFFKSFPFGTDFTDEEIVLGRAL
RQFKQKAEENKFAIMPGLIGQGLSSIPKTARPYLERMGLEDPETMQEKLMQKIVLFALKS
SGAI
Download sequence
Identical sequences C0QKG0
177437.HRM2_09180 WP_012663271.1.52472 gi|224368032|ref|YP_002602195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]