SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0QPT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0QPT6
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily PEBP-like 1.1e-46
Family Prokaryotic PEBP-like proteins 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0QPT6
Sequence length 154
Comment (tr|C0QPT6|C0QPT6_PERMH) Uncharacterized protein {ECO:0000313|EMBL:ACO04282.1} KW=Complete proteome; Reference proteome OX=123214 OS=Persephonella marina (strain DSM 14350 / EX-H1). GN=PERMA_0895 OC=Bacteria; Aquificae; Aquificales; Hydrogenothermaceae; Persephonella.
Sequence
MEPIIVKSMSFDEGEPIPVDYTCDGMDISPEIVWDNVPEETKSFVLIMEDPDAPMGVFTH
WVVYDIPSSLRLLPENFPKVPQIDGIKQGINDFGRIGYGGPCPPRGSTHRYVFNVYAISV
VSLELPTGATKKIVEERMEGKILSKGKLTGIYGR
Download sequence
Identical sequences C0QPT6
gi|225850448|ref|YP_002730682.1| 123214.PERMA_0895 WP_012676520.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]