SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0R5F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0R5F2
Domain Number 1 Region: 543-1032
Classification Level Classification E-value
Superfamily ALDH-like 6.15e-132
Family ALDH-like 0.0000003
Further Details:      
 
Domain Number 2 Region: 178-523
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.81e-107
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000175
Further Details:      
 
Domain Number 3 Region: 8-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.96e-57
Family N-terminal domain of bifunctional PutA protein 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C0R5F2
Sequence length 1046
Comment (tr|C0R5F2|C0R5F2_WOLWR) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome OX=66084 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi). GN=WRi_001480 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MISSIQEPNELRKRLQGFYRTDEKSYIRYLVEKAELSADSKNRIYNIAKQVIEKIKHNKL
SIVDSFMQQYSLSNDEGIALMCLAESLLRIPDDYTIDELIKDKIANQEWSKYLGYSSSLF
VNASMWSLMIGSSILRDNEGDSKFYYAISKLLKNLGEPIIRKAVKQAMSMLGNHFVVGET
IEEALRYAKLDDNSKFLYSFDMLGEAAHTTEDAEEYFNSYMHSIKAIGESTEINDCFKSH
GISIKLSALHPRYEFSQFGRIAGEIFTKVLELCREAKKYNISLCIDAEETERLEISLILF
EQLRLDESLSEWEGLGLAVQAYQKRALSVLDFVEDVAIRSKHKIMVRLVKGAYWDSEIKC
TQELGLNDYSVFTRKSYTDVSYLVCAQKLLSKPNSFYPCFGTHNVYTFASIMELADKNHP
GFEFQRLHGMAKDLYDYAMSELATNVSCRVYAPVGEHSDLLPYLIRRLLENGANSSFVNQ
ISNPNVKIDELISDPLEKAINFNYEPHPGIPLPQDILGPERKNSLGMDISDSVIVSQFAD
DIKGFSEKKWQVGPIIDGKALFDNAEFIEVVNPAHLENVIGEVSSATSDQALNALEIAHS
AFAKWQNVSAEERAKCLEKAADLLEERMKELIYILIVEAGKILSDAIAEVREAIDFLRYY
AMIAKNELSDWKKLPGPTGEDNFIFFEGRGVFLCISPWNFPLAIFIGQVSAALAAGNAVL
AKPAEQTPIIAYEAVKILHEAGIPKNVLHLIPGDGGYLGKILVPDNRIAGVAFTGSTQTA
QIINKMLANRDGPIVPLIAETGGLNAMIVDSSALLEQVTTDVLLSAFRSAGQRCSALRVL
FIQEDIAEKQIKMICGAAQELKIGDPIQLSTDIGPIIDKASIDMLTQHTQKMSEDKDSNL
LFKVPMDTNSHNGYFFPPYIYEIQKISQLKQEVFGPILHIIRFNKSQLNEVISDINSTGY
GLTFSLQSRIQSQIDTISKKISVGNVYINRNQIGAAVGIQPFGGRGLSGTGPKAGGPHYL
QRFSTEKVVSVNTTAFGGNTTLMCLD
Download sequence
Identical sequences C0R5F2
WP_012673071.1.1538 WP_012673071.1.47613 gi|225629994|ref|YP_002726785.1| 66084.WRi_001480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]