SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0Z981 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0Z981
Domain Number 1 Region: 51-221
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.97e-37
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0Z981
Sequence length 236
Comment (tr|C0Z981|C0Z981_BREBN) Uncharacterized protein {ECO:0000313|EMBL:BAH42551.1} KW=Complete proteome; Reference proteome OX=358681 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599). GN=BBR47_15740 OC=Brevibacillus.
Sequence
MSRFIVEDDFWSLFPHAKIGIVICQGIDNSSRDVEKYEKLLREAEKEAHKFLRLEEFSSN
PVISVWREAFQKFKTKKGARCSIEALLKRVKNGNPIGTINPLVDIYNSISLRYGFPCGGE
DIDTFVGDIRLTQANGNEPFLPLGQDENASPYEGEIVYKDDEGAICRCWNWREAQRTMLT
ENTKNAFLCMELVDETRIDEFHMALKELSDLVPLHLGGMVKMEVLDIHQKEMTLYS
Download sequence
Identical sequences C0Z981
358681.BBR47_15740 WP_012685300.1.45054 gi|226311161|ref|YP_002771055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]