SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1ADZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1ADZ2
Domain Number 1 Region: 132-201
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000022
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1ADZ2
Sequence length 203
Comment (tr|C1ADZ2|C1ADZ2_GEMAT) Uncharacterized protein {ECO:0000313|EMBL:BAH40719.1} KW=Complete proteome; Reference proteome OX=379066 OS=100505). GN=GAU_3677 OC=Gemmatimonas.
Sequence
MTKLDLKKDLRHLYAPSAKDVAVVDVPSMHFLMIDGEGDPNHAPAYAEAVEALFTLAYAI
KFAVKKGPAGIDYGVMPLEGLWWADDMSAFTTGDRSQWQWTMMIMQPDFVNASLVADITK
EVTRKKNPVALPLVRFEAFAEGPAAQVMHLGPFSEEGPTIERLHGFIEASGRQLAGKHHE
IYLSDIRKAAPDKWKTVVRQPLR
Download sequence
Identical sequences C1ADZ2
379066.GAU_3677 gi|226229083|ref|YP_002763189.1| WP_015895486.1.17207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]