SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1B4Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1B4Z3
Domain Number 1 Region: 213-321
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-27
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0061
Further Details:      
 
Domain Number 2 Region: 15-108
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.41e-27
Family Ferredoxin reductase FAD-binding domain-like 0.00067
Further Details:      
 
Domain Number 3 Region: 106-229
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.31e-25
Family Aromatic dioxygenase reductase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1B4Z3
Sequence length 322
Comment (tr|C1B4Z3|C1B4Z3_RHOOB) Oxidoreductase {ECO:0000313|EMBL:BAH50919.1} KW=Complete proteome OX=632772 OS=Rhodococcus opacus (strain B4). GN=ROP_26720 OC=Rhodococcus.
Sequence
MSQNPVSSGTPADAALRVDAKVVVAEGVVALTLRHPTGRRLPDWAPGAHIDLVLPNGLTR
QYSLCGDRWDAHSYRVGVLREPSGRGGSAYVHDELAVGDLVGVGGPRNNFPLVPSQKYLF
VAGGIGITPLLPMIRQAELIGADWRLVYGGRTRTSMAFREELAAYGDRVVFLPRDERGLP
DLPAYLAEATDAKVYVCGPGALLAAVEKCCADWAVGRLRTERFVPKDRGAPLRNEPFEVE
LARSGLAVTVNPGATVLDAVQAAGVNVLSSCRGGTCGTCETTVLAGAPDHRDSVLDDDER
SAGDCMLICVSRSCSDRLVLDL
Download sequence
Identical sequences C1B4Z3
gi|226362086|ref|YP_002779864.1| 632772.ROP_26720 WP_012689875.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]