SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1D163 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1D163
Domain Number 1 Region: 91-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000902
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1D163
Sequence length 155
Comment (tr|C1D163|C1D163_DEIDV) Uncharacterized protein {ECO:0000313|EMBL:ACO45587.1} KW=Complete proteome; Reference proteome OX=546414 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923). GN=Deide_07290 OC=Deinococcaceae; Deinococcus.
Sequence
MDWLPTLERIQSWHWWVLGALLLILEVFAPGVFFVWLAMAAFMLGLLVFVLPLPVTLQLL
LFALLSVVAVLIGRRYVNRLILGGDEGESMNRGASRLVGRTVVVTSAIRNGVGRVRVGDS
DWRATGPDVPEGANVLIVSAEGTTLHVREINGTWV
Download sequence
Identical sequences C1D163
WP_012692710.1.1337 546414.Deide_07290 gi|226355601|ref|YP_002785341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]