SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1D7L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1D7L2
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.34e-56
Family G proteins 0.00023
Further Details:      
 
Domain Number 2 Region: 166-288
Classification Level Classification E-value
Superfamily Translation proteins 5.96e-29
Family Elongation factors 0.0063
Further Details:      
 
Domain Number 3 Region: 399-493
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.12e-26
Family EF-G/eEF-2 domains III and V 0.022
Further Details:      
 
Domain Number 4 Region: 294-370
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.12e-18
Family EF-G/eEF-2 domains III and V 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1D7L2
Sequence length 597
Comment (sp|C1D7L2|LEPA_LARHH) Ribosomal back-translocase LepA {ECO:0000255|HAMAP-Rule:MF_00071} KW=Complete proteome; Reference proteome OX=557598 OS=Laribacter hongkongensis (strain HLHK9). GN=LHK_01463; OC=Chromobacteriaceae; Laribacter.
Sequence
MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLEMREMSEQVLDSMDIEKERGITIKAQTAA
LSYKARDGQVYHLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI
ELGVEVVPVLNKIDLPAAEPERVSQEIEDIIGIEAIDAVRASAKSGIGIEDILETVVQKI
PAPKGDADAPLKALIIDSWFDNYVGVVMLVRLVDGAVKPKDKIKFMATGAEHLVEQVGVF
TPKSVQRSELRAGEVGFIIAGIKELKSAKVGDTITQVARPAAEALPGFKEVQSQVFAGLY
PVESHDYDNLRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLEREFD
MDLITTAPTVVYELLLKDGTVIEVENPSKLPDPSKIEEIREPIITSTILVPQDYVGAVMT
LCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKCFQASDL
VKLDVMVNGEKVDALSLIVHRQNAIYRGRELVSKMRELIPRQMFDIAVQAAIGNNIIARE
TVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQEAFLAILQVSDK
Download sequence
Identical sequences C1D7L2
gi|226940387|ref|YP_002795461.1| 557598.LHK_01463 WP_012696938.1.72885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]