SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1DAR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1DAR4
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-106
Family G proteins 0.000000037
Further Details:      
 
Domain Number 2 Region: 483-604
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-42
Family Translational machinery components 0.000016
Further Details:      
 
Domain Number 3 Region: 271-408
Classification Level Classification E-value
Superfamily Translation proteins 4.29e-34
Family Elongation factors 0.0000992
Further Details:      
 
Domain Number 4 Region: 608-694
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.06e-30
Family EF-G/eEF-2 domains III and V 0.00013
Further Details:      
 
Domain Number 5 Region: 406-484
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.15e-25
Family EF-G/eEF-2 domains III and V 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1DAR4
Sequence length 698
Comment (sp|C1DAR4|EFG_LARHH) Elongation factor G {ECO:0000255|HAMAP-Rule:MF_00054} KW=Complete proteome; Reference proteome OX=557598 OS=Laribacter hongkongensis (strain HLHK9). GN=LHK_00250; OC=Chromobacteriaceae; Laribacter.
Sequence
MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTTFWKGMSLQFPEHRFNIIDTPGHVDFTVEVERSMRVLDGAVMVYCAVGGVQ
PQSETVWRQATKYKVPRLAFVNKMDRQGANFFRVVEQMQTRLRANPIPVVVPIGAEDGFE
GVVDLLKMKAIIWDEASQGMKFEYGDIPAGLESVAQEWREKMVEAAAEASEELMNKYLEE
GELSEEEIIGGLRTRTLNCEIQPMLCGTAFKNKGVQRMLDAVIELLPSPIDVPPITGEED
GQPAIRPASDEAPFSALAFKLMNDPYVGQLTFFRAYSGVVSSGDTVLNSVKDKKERIGRI
VQMHANDRKEIDEVRAGDIAAAIGLKDVTTGETLCAVDAPIILERMEFPEPVIHVAVEPK
TKADQEKMGIALGRLAREDPSFRVRTDEESGQTIISGMGELHLEIIVDRMKREFGVEANV
GAPQVAYRETITKTVTDVDGKHVKQSGGKGQYGHCVITLEPSGEGKGYQFFDEIKGGVIP
REFIPSVDKGIQNTLNNGILAGFPVVDVTVRLTFGSYHDVDSSQIAFELAGSMAFKEAMR
RASPVILEPMMAVEVETPEEYMGDVMGDLSRRRGIVQGMDDDGLGGKKVRAEVPLAEMFG
YSTDLRSATQGRATYSMEFKHYSEAPRNVAEAVMAARK
Download sequence
Identical sequences A0A248LEY4 C1DAR4
WP_012695740.1.72885 WP_012695740.1.92876 gi|226939183|ref|YP_002794254.1| 557598.LHK_00250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]