SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1F1J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1F1J1
Domain Number 1 Region: 15-243
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.28e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 289-339
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000353
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1F1J1
Sequence length 345
Comment (tr|C1F1J1|C1F1J1_ACIC5) Glycyl-tRNA synthetase alpha subunit {ECO:0000256|HAMAP-Rule:MF_00254} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_0592 OC=Acidobacterium.
Sequence
MASAPKNHSQSKPLTFQEVLFRLQSYWAERGCVLQQPYDVEVGAGTMSPDTFLRVLGPEP
INIAYAQPSRRPADGRYGENPNRLYKHTQLQVILKPPPADIQDLYLKSLEAIGIDLREHD
IKFEEDNWEWPVGGAWGVGWQVMLDGLEITQFTYFQQCGGMDLDPISGEITYGLERLCAF
LQDVDSIYDIVWARDPRNGREVTYGEIRLQEELQLSVYNFEAADIGKLWEHLRLYEAECQ
ALLANFHESFSPKAEKKAERHEKIHERVVHDGAGVPASEDVVQSLRRFPVLGAYELCLKC
SHLFNLLDARGAISVTERVAVMARIRNMVVGVAKAYRQQSVGLSA
Download sequence
Identical sequences C1F1J1
240015.ACP_0592 gi|225872265|ref|YP_002753720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]