SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1F228 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1F228
Domain Number 1 Region: 16-197
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.72e-51
Family Biotin holoenzyme synthetase 0.00034
Further Details:      
 
Weak hits

Sequence:  C1F228
Domain Number - Region: 225-265
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.00156
Family Biotin repressor (BirA) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1F228
Sequence length 272
Comment (tr|C1F228|C1F228_ACIC5) Biotin--acetyl-CoA-carboxylase ligase {ECO:0000313|EMBL:ACO32460.1} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_2581 OC=Acidobacterium.
Sequence
MEAAVQALDLNAMNAALAETPFAGRITLFPAITSTNTHAMAEGDAGAAHGSVYVAEEQTG
GRGRGAHAWASPPGSGLYVSVLLRPQMAPGDALWISLAAGLAVRHAVEEMTTLQADLRWP
NDLMLGKKKFCGILTEMHAEATRVRHVVVGIGINVLQMAFPEGLDAMATSLQIETGLQWS
RQDLLVALLQALDREMSALGDAMRMDAAKQSILERIERASSWVRGKRVRVDEGAGFAGVT
DGLNAQGFLQVRTQDGIRTVLSGGVREDDGGR
Download sequence
Identical sequences C1F228
gi|225874145|ref|YP_002755604.1| WP_015897649.1.62785 240015.ACP_2581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]