SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1F4V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1F4V3
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.42e-35
Family DNA-binding N-terminal domain of transcription activators 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1F4V3
Sequence length 136
Comment (tr|C1F4V3|C1F4V3_ACIC5) Transcriptional regulator, MerR family {ECO:0000313|EMBL:ACO32097.1} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_1225 OC=Acidobacterium.
Sequence
MERLTISQVAKRSGVNIQTIRYYERQGLLSARSRTAAAYRIFSVESVQRIRFIKRAQELG
FSLKEIKELLSLRMDTHTTQADIRKQAQTKIADVERKILHLEAIRASLLRMAENCSGCGS
LKDCPILESLDKEDPE
Download sequence
Identical sequences C1F4V3
gi|225872865|ref|YP_002754322.1| WP_015896374.1.62785 240015.ACP_1225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]