SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1F7U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1F7U8
Domain Number 1 Region: 88-273
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-61
Family B3/B4 domain of PheRS, PheT 0.0000127
Further Details:      
 
Domain Number 2 Region: 363-582
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.83e-35
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0003
Further Details:      
 
Domain Number 3 Region: 591-687
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.67e-17
Family Anticodon-binding domain of PheRS 0.0016
Further Details:      
 
Domain Number 4 Region: 296-371
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000165
Family Domains B1 and B5 of PheRS-beta, PheT 0.0023
Further Details:      
 
Domain Number 5 Region: 1-77
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000897
Family Domains B1 and B5 of PheRS-beta, PheT 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1F7U8
Sequence length 688
Comment (tr|C1F7U8|C1F7U8_ACIC5) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_1830 OC=Acidobacterium.
Sequence
MRILTQWLRDYVALPSISDAELADALTLRGIAVDGVFDLGAHGSVFEMDVTTNRVDAMNH
YGVAREASIIFGCALKPLDGSLPAPKPGSAFPVRIEEPTLCGRFTARVLRGVTIQPSHGI
VAERFAALEQKLISNAVDATNFVTLGMGHPTHAFDLDKLEGGIVVRRARKGEKLVTLDGV
ERTLDPDDLVVADEKKAVGLAGVMGGLDTAISASTKNILVEAAWFDQNTVRRSSRRHGIH
TDASHRFERGADFNAPPLANALVSRIILEAGGHIEGELVDVLIPEAEARTAKRAAVSFAV
PEIARILGATEDPQGITAADAEGILTGLGCTLEKSGEQSYSVTLPSWRLDLEREIDLLEE
IARVYGYNRFQNTLPTFAGSVVELPWAAKEATLRGKLLGLGWNEAISSTFCAEADALAFC
REPNSAVAVGNPLSEEAGMLRPSLLPGMLTMLANNLSRDVESVALFEIGTVFTGSTEKVD
ERPALAIGATGRPFGAGEVDFYDLKGTLQELLHSFTARSLYFDRFPAESGLMPAWLHPGR
SARAVIDGATVGYFGQLHPAEAERRKVKQTVLVGELYLDRLYKQSLRTPVIEELSRYQAV
RRDFSFLVPDAVSWGQLAEAIVALPIPELRSFAPREILRGERVAAGHYSLLLGTVFQSHE
RTLRDEDLQAWAQQVIAAMQDRGAQLRS
Download sequence
Identical sequences C1F7U8
240015.ACP_1830 gi|225873445|ref|YP_002754904.1| WP_015896950.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]