SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1F8F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1F8F1
Domain Number 1 Region: 6-256
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.32e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000413
Further Details:      
 
Domain Number 2 Region: 257-277,320-435,479-539
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 5.1e-50
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000173
Further Details:      
 
Domain Number 3 Region: 651-808
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.36e-45
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.069
Further Details:      
 
Domain Number 4 Region: 549-651
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000024
Family AlaX-M N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1F8F1
Sequence length 982
Comment (tr|C1F8F1|C1F8F1_ACIC5) Alanyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00036} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_1962 OC=Acidobacterium.
Sequence
MQYRSGSDIRETFLRFFETKGHRRVHSSSLVPANDPTLLFTNAGMNQFKDVFLGLEHRDY
ARATTSQKCVRAGGKHNDLENVGFTRRHHTFFEMLGNFSFGDYFKADAIAYAWELVTSLD
WLGIPKEKLYVTIFKGENGVPRDEEAYELWRGQGVPAERIFEFGAKDNFWQMGDTGPCGP
CSEIFYDMGMDAAETPGVDKPFGQDDARYVEIWNLVFMQFDRSANGELALLPKPSIDTGA
GLERLASVLQGKVSNFETDLFTPLIQKAAELTGVRVSQSASQQVSEPAKGSQGEGDVSGN
DLSRAAHGAKQEGVLAPEGKELTGNASLRIIADHARAATFLISDGVLPANEGRGYVLRKI
LRRGIRHGRLLGQEQPFMGQMVYAVRDEMQVAYPELKESAERVAKVVEAEERQFARVLEV
GSAQLDQLIRSEAAGNGSDSGDRWGSGAGTGDGAGFGDGSGFGGGSGSGAGFGDGSGSER
RVLHGREAFHLYETYGLPLDFMMDAARDAGIDFDLTGFEEARAEEQARARASWKGGAKQS
ASPVYRELPKTIFEGYGKLRVEGAEVLAIVKDGQGVKAANPGDAVEVVLNATSFYADSGG
QMGDHGWLYSDDHNSVVAEVSGCTKPVQGVFAHKAVLRQTLALGDKVDTVVDADFRAATR
RNHTGTHLLHAALREVLGTHVKQAGSLVEPGRLRFDFSHFTQIADEELKDIEDLINRQVL
VNTRVETIEDVPIDVAVNEYHAMALFGEKYGERVRVVKIGDFSTELCGGTHTGATGEIGV
VKLMSEGSVSSGVRRVEAVTGLGALDEFRRGYQVAQLAAQLAPSAEMSPAEALQHRLAAQ
DEELKKLKRELDQVRMKSAASAVSGAANQAAEVNGVKVLAQRVDQLDRGQMRTLVDNLRN
QLGSGVVVLGSAQEEGKVALIVGVTKDLTGKVQAGKVVAQVAKQVGGSGGGRPDMAEAGG
KDASQLDAALAGVPEVVKALLG
Download sequence
Identical sequences C1F8F1
WP_015897073.1.62785 240015.ACP_1962 gi|225873568|ref|YP_002755027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]