SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1FAE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1FAE8
Domain Number 1 Region: 121-302,446-608
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.93e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000537
Further Details:      
 
Domain Number 2 Region: 10-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-32
Family Anticodon-binding domain 0.0000936
Further Details:      
 
Weak hits

Sequence:  C1FAE8
Domain Number - Region: 302-429
Classification Level Classification E-value
Superfamily GAD domain-like 0.0154
Family GAD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1FAE8
Sequence length 610
Comment (sp|C1FAE8|SYDND_ACIC5) Non-discriminating aspartyl-tRNA synthetase {ECO:0000255|HAMAP-Rule:MF_00044} KW=Complete proteome; Reference proteome OX=240015 OS=NBRC 15755 / NCIMB 13165 / 161). GN=ACP_2346; OC=Acidobacterium.
Sequence
MLDFLGTKQRTHTCGELRAAHAGETITIMGWVNRRRDHGNLIFLDLRDRYGITQVVLDKD
LSAEAHAKAEQARPEYVICATGKVRARSQEAINPKMPTGEIEIAATELLILNDSKVPPFS
PAEEAIANEEVRLKYRYLDLRRPEMQHNFEVRHKVALAVRQYLSGQGFFEVETPFMTRST
PEGARDYLVPSRVHPGEFYALPQSPQLFKQILMISGMDRYFQIARCFRDEDLRADRQPEF
TQIDLEMTFPQQETIFGVVEGFLAAAFEAVGQQITVPFPRMTYDKAIELYGIDKPDLRLP
PMTDVRSVFSDEELQSLKIEPGMPIVAIVIPNKSAMSNTQKKAFGKEVEEQVGAELAYLD
VERLRTSPQFALLADRIDAAAAAHCKLERVEPDHRLVVISPRLGAAAVSRDTSWVYKRAG
QLRLELGKRFAAEHKAFEKKGTAADYQFLWVTDFPFFEWDEQSHTWTFAHHPFTSPHQDD
LIAGRLESDQAAVRALAYDVVLNGTELGSGSIRIHRQDVQQQIFRALGMSDDEAKERFGF
FLEALQYGTPPHGGIALGLDRIVMILAGASSLREVIAFPKTAKAIDLMVDAPTPVSDAQL
RELHIRPTKQ
Download sequence
Identical sequences C1FAE8
WP_015897436.1.62785 gi|225873931|ref|YP_002755390.1| 240015.ACP_2346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]