SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1LIB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1LIB4
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily Mitochondrial ATP synthase coupling factor 6 1.2e-23
Family Mitochondrial ATP synthase coupling factor 6 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1LIB4
Sequence length 110
Comment (tr|C1LIB4|C1LIB4_SCHJA) ATPase, F0 complex, subunit F6, mitochondrial,domain-containing protein {ECO:0000313|EMBL:CAX74442.1} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MVINQRCLCDAAGASRVKDPIQLAFISKLREYRQKSEKSEVGLADASPKEIKELNEMLAK
VDRIYGAESDDMTQFPVFKFEDPSVVIPTSSLRIEYPDETENAEEVNKHV
Download sequence
Identical sequences C1LIB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]