SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C2JUV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2JUV3
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.93e-18
Family MarR-like transcriptional regulators 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C2JUV3
Sequence length 140
Comment (tr|C2JUV3|C2JUV3_LACRH) Transcriptional regulator, MarR family {ECO:0000313|EMBL:EEN81176.1} KW=Complete proteome OX=525361 OS=Lactobacillus rhamnosus LMS2-1. GN=HMPREF0539_0687 OC=Lactobacillus.
Sequence
MTMKKQYLSASQSVNQFNRLFSPVSTADIPLNQQNLLFWMATDSTPRTPTNLAKEMHVTK
AAITKASGPLLERGLLDKQPDPEDCRSFKLVLSEAGEKAVEDLGPEYLGNLERLYNELGE
KKYLKLIKLLSQATGVTVKE
Download sequence
Identical sequences A0A249N4X1 C2JUV3 K8Q5Z5
gi|523521091|ref|YP_008207171.1| gi|523518134|ref|YP_008204216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]