SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C2XPF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2XPF8
Domain Number 1 Region: 60-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.3e-82
Family L-arabinose binding protein-like 0.0000136
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.04e-18
Family GalR/LacI-like bacterial regulator 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C2XPF8
Sequence length 323
Comment (tr|C2XPF8|C2XPF8_BACCE) Transcriptional regulator {ECO:0000313|EMBL:EEL72455.1} KW=Complete proteome OX=526990 OS=Bacillus cereus AH603. GN=bcere0026_5590 OC=Bacillus cereus group.
Sequence
MSTIKDVAKLAGVSVATVSRVLNKNGYVHEDTLKKVERAIEMLDYKPSTVARSLYNKKSR
LIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDENLEKEKQYIDVLRQNNVDGFI
VATNPQNSVNYMNLSIPVVAIDRMFNERIPTVYADNYAGSQAATKLLIDKGCKHIAHIRG
PRDVSTANERFEGFVDVITQNNLSYMIAESTFDPANSEQVAVELLEEYPHIDGIVAGNDL
IAIGIVKAALQKGISIPNDLQIIGFDGISLTEMMYPSITTVAQPIYEMGKIATELLLEQM
EGNPLEEKHYRLPIEIIERNTTK
Download sequence
Identical sequences A0A0A0WUE9 A0A243AK61 A9VEU4 C2SFI3 C2XPF8 J7T2H1 J8CP42 J9CU88 R8CJ41 R8CR20 R8HPE3
gi|163938587|ref|YP_001643471.1| WP_002029805.1.17940 WP_002029805.1.30061 WP_002029805.1.39317 WP_002029805.1.4496 WP_002029805.1.47957 WP_002029805.1.50411 WP_002029805.1.52845 WP_002029805.1.57105 WP_002029805.1.64566 WP_002029805.1.68668 WP_002029805.1.76817 WP_002029805.1.85012 WP_002029805.1.99908 315730.BcerKBAB4_0578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]