SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C2XU04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2XU04
Domain Number 1 Region: 68-195
Classification Level Classification E-value
Superfamily RmlC-like cupins 3.71e-22
Family TM1287-like 0.059
Further Details:      
 
Domain Number 2 Region: 11-80
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.24e-18
Family SinR domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C2XU04
Sequence length 197
Comment (tr|C2XU04|C2XU04_BACCE) Transcriptional regulator, XRE {ECO:0000313|EMBL:EEL70897.1} KW=Complete proteome OX=526990 OS=Bacillus cereus AH603. GN=bcere0026_21750 OC=Bacillus cereus group.
Sequence
MYYDGRKEVVTMIHYRLGQTVLSYRKKNNMTIREFADYAGISTSLISQIERGHANPSLNV
LELIAKALNVPLFTLFINDIDTDSLISKKKDRKKVYRENNDHIVYDVLTPDFMKARIEML
MMDLNGYANTTESHYSHEDKEEIAVVMKGEVYVELEGNEYFLEEGDVVRIPPNVKHRFLN
KSDEMNHILFVLTPSLS
Download sequence
Identical sequences A0A1W6A8D0 A9VF72 C2XU04
WP_002065351.1.45835 WP_002065351.1.76817 gi|163940192|ref|YP_001645076.1| 315730.BcerKBAB4_2228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]