SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3KMU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3KMU3
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3KMU3
Sequence length 150
Comment (tr|C3KMU3|C3KMU3_SINFN) Uncharacterized protein {ECO:0000313|EMBL:ACP21516.1} KW=Complete proteome; Reference proteome OX=394 OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234). GN=NGR_b00430 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MILRLAIAGGLIAATVTIQAFFMSAGLRAFRQMEKDRPDFLSHYPTLVTVAWVIYLIIPI
LFDVCLWAAFYYLAQALPSFEDALYFSTVTFTTVGYGDIVLDRDWRQVATFEAINGWIIF
GWATALMMAVIQRLYFRTDPQAMDDGDPKG
Download sequence
Identical sequences C3KMU3
gi|227818298|ref|YP_002822269.1|NC_012586 394.NGR_b00430 YP_002822269.1.63916 gi|227818298|ref|YP_002822269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]