SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3MPK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3MPK5
Domain Number 1 Region: 7-209
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.02e-31
Family FAD-linked oxidases, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 385-410
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.00000425
Family Vanillyl-alcohol oxidase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3MPK5
Sequence length 411
Comment (tr|C3MPK5|C3MPK5_SULIL) FAD linked oxidase domain protein {ECO:0000313|EMBL:ACP35318.1} KW=Complete proteome OX=429572 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1). GN=LS215_1309 OC=Sulfolobus.
Sequence
MFMMKLDELEKELGSKLIMNDNVIDHYSKSPYLVSPILSKMGKRVLGVVIVEDRYDVEFV
VKFCDIHRIPLLARGAGTSTIGQVLPIHPSIVLDIQKLNKTMEYDEKYLKISPGVKVLDA
LNYLRKRGKELQVYPSSFYISTLGGYIAGGDVGIGSYQYGYHFHNGGIRRVKIVGPTGTF
ELTGENTLAVAQAAGTTGIIIGADIATVDYEDWKDQIIRFDELGKLVKFLKDAENERDKI
RRITIEDQEALSLVAKNRVAPGKWNVIVASTKSFGEEVDMKFLDELAFAAIYVTMSRLTN
FSDYFYEVRLLSLNSFLKVVSQVKDALGSNVLIHGDVMTLRGETVIYTVFISDRLNFDII
DSIMTKEGIPFEIHSLVVNDRVDEEYRLELMKKYKRIVDPHDILNPGKLRV
Download sequence
Identical sequences C3MPK5 C3NHW7 D2PJP6
gi|284997602|ref|YP_003419369.1| WP_012713630.1.34992 WP_012713630.1.52267 WP_012713630.1.66823 419942.YN1551_1641 429572.LS215_1309 gi|229582250|ref|YP_002840649.1| gi|227830183|ref|YP_002831963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]