SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3N807 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3N807
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000108
Family Cgl2762-like 0.044
Further Details:      
 
Weak hits

Sequence:  C3N807
Domain Number - Region: 7-54
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0179
Family Transcriptional factor domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3N807
Sequence length 244
Comment (tr|C3N807|C3N807_SULIY) Insertion element protein {ECO:0000313|EMBL:ACP46294.1} KW=Complete proteome OX=439386 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1). GN=YG5714_0385 OC=Sulfolobus.
Sequence
MGRKPVFRQDVSCPSCGSHHVVKCGRPLGRQKFLCRDCGKYFLGDASYHHHSRKLREEAL
RMYANGMSMRAISRVLNVPLGTVFTWIKRYGRKKHEKLVELWGRAKELVKGKVVAKVVDE
MWTYLYKNARAFYKWVFTCYVYTKLGVYLIYSVGDRDESTFLEVKKYLPDEGRWVSDDYN
LYFWLKDHTVVSPVNPNESFHSSLRDRLIRFKRATKAVNRSIRTMMYSIALVLWERRLIP
EFVA
Download sequence
Identical sequences C3N807 C3NFY4
WP_012715555.1.13477 WP_012715555.1.52267 419942.YN1551_0620 419942.YN1551_0995 419942.YN1551_1900 419942.YN1551_2134 419942.YN1551_2236 419942.YN1551_2535 419942.YN1551_2667 439386.YG5714_0385 439386.YG5714_0545 439386.YG5714_0630 439386.YG5714_0860 439386.YG5714_0961 439386.YG5714_2040 439386.YG5714_2295 439386.YG5714_2349 439386.YG5714_2380 gi|229578200|ref|YP_002836598.1| gi|229578363|ref|YP_002836761.1| gi|229578447|ref|YP_002836845.1| gi|229578664|ref|YP_002837062.1| gi|229578757|ref|YP_002837155.1| gi|229579817|ref|YP_002838216.1| gi|229580066|ref|YP_002838466.1| gi|229580117|ref|YP_002838517.1| gi|229580148|ref|YP_002838548.1| gi|229581273|ref|YP_002839672.1| gi|229581625|ref|YP_002840024.1| gi|229582481|ref|YP_002840880.1| gi|229582675|ref|YP_002841074.1| gi|229582750|ref|YP_002841149.1| gi|229583003|ref|YP_002841402.1| gi|229583110|ref|YP_002841509.1| 2014010483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]