SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3NB57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NB57
Domain Number 1 Region: 229-496
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.52e-58
Family PFOR Pyr module 0.081
Further Details:      
 
Domain Number 2 Region: 508-625
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-21
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.048
Further Details:      
 
Domain Number 3 Region: 1-251
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000000000107
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3NB57
Sequence length 632
Comment (tr|C3NB57|C3NB57_SULIY) Pyruvate flavodoxin/ferredoxin oxidoreductase domain protein {ECO:0000313|EMBL:ACP46873.1} KW=Complete proteome OX=439386 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1). GN=YG5714_2645 OC=Sulfolobus.
Sequence
MRISWMIGGAQGSGVDTSANIFGNAVAASGYYIYGNREYYSNIKGRHSYFNLTISDKPPR
SIAQQVEILTSFDAETIFQHFNEVKDVLIYSTEVESTKAEQVQSMEPEITEHVIKFLKEK
GYGTTVRDVINYLKKEKGVKVIPIDYMEILKKVADQAKVQLSVADRARNTIAIAASYKLL
GLREQYLLNSITRTFRQEVFAKINTIASQLAMQPIQPMYNLPELPNNEEKINLDGNTAAA
IGKIYGGLRFQSYYPITPASDESVFIEAHQTVFTVDPKTGEKRKSTIVVVQAEDELAAIN
MASGAALTGVRAATATSGPGFSLMVEGMGWAGMNEVPVVITYYIRGGPSTGQPTRTSQAD
LMFALNAGHGEFPRIVIASGDHVEAFHDGTWALNLAQKYQTPVIHLVDKALANSYSIIPK
KQLGMENIRVEKGKIVINSSTPELKRFEITEDGISPFAPLGTTRIHYTGDEHDEYGFIAE
ASENREKMYEKRIKKLFTADKEIPEENRVNIFGNTDSKIAIITWGSPKGAILDAMEELES
EGIKPMLIQIRMFSPFPKNLMKKLLSGREFIIDVESNYFGQAGEVLKLNTEIEPTHHILK
WNGRPMMRDEVKEAIKAVVQKGERKVVLHGGA
Download sequence
Identical sequences C3NB57 C3NKG7
419942.YN1551_0267 439386.YG5714_2645 gi|229580395|ref|YP_002838795.1| WP_012716724.1.13477 WP_012716724.1.52267 gi|229580970|ref|YP_002839369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]