SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3NH76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NH76
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000108
Family Cgl2762-like 0.044
Further Details:      
 
Weak hits

Sequence:  C3NH76
Domain Number - Region: 7-54
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0179
Family Transcriptional factor domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3NH76
Sequence length 244
Comment (tr|C3NH76|C3NH76_SULIN) Insertion element protein {ECO:0000313|EMBL:ACP48486.1} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_1393 OC=Sulfolobus.
Sequence
MGRKPVFRQDVSCPSCGSHHVVKCGRPLGRQKFLCRDCGKYFLGDASYHHHSRKLREEAL
RMYANGMSMRAISRVLNVPLGTVFTWIKRYGRKKHEKLVELWGRAKELVKGKVVAKVVDE
MWTYLYKNARAFYKWVFTCYVYTKLGVYLIYSVGDRDESTFLEVKKYLPDEGRWVSDDYN
LYFWLKDHTVVSPVNPNEPFHSSLRDRLIRFKRATKAVNRSIRTMMYSIALVLWERRLIP
EFVA
Download sequence
Identical sequences C3NH76
WP_012717432.1.52267 gi|229582009|ref|YP_002840408.1| gi|229582695|ref|YP_002841094.1| gi|229582707|ref|YP_002841106.1| 419942.YN1551_1393 419942.YN1551_2161 419942.YN1551_2176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]