SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3NHF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NHF3
Domain Number 1 Region: 8-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.22e-51
Family Extended AAA-ATPase domain 0.000000342
Further Details:      
 
Domain Number 2 Region: 229-319
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.3e-23
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3NHF3
Sequence length 330
Comment (tr|C3NHF3|C3NHF3_SULIN) Clamp loader small subunit {ECO:0000256|HAMAP-Rule:MF_01509} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_1473 OC=Sulfolobus.
Sequence
MSAKVEEILWAEKYRPRTLDDIVNQREIIDRLKKFVKEKNMPHLLFAGPSGTGKTTAALA
LVHDLYGDNYVEYFLELNASDERGIDVIRNKVKEFARTVIPSNVPFKVVLLDEADNMTAD
AQQALRRTMELYTENTRFILACNYLSKIIEPIQSRTALFRFYPLKKEDVVNRLVYIAKNE
KAEYDQKALETIYDITMGDMRKSINILQAASAYGKISVEAVFKVLGLAQPKEVREMISLA
LQGKFTQAREKLRTLLVTYGLSGEDIIKQIHREITSSELQISEELRVLLLDYIGETEFRI
IEGADDEIQLSALLAKMAIYGNKYIGSENK
Download sequence
Identical sequences C3NHF3
419942.YN1551_1473 gi|229582086|ref|YP_002840485.1| WP_012717454.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]