SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3NKM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NKM0
Domain Number 1 Region: 9-252
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 7.33e-82
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000224
Further Details:      
 
Domain Number 2 Region: 239-394
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.24e-51
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3NKM0
Sequence length 400
Comment (tr|C3NKM0|C3NKM0_SULIN) Acyl-CoA dehydrogenase domain protein {ECO:0000313|EMBL:ACP47500.1} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_0323 OC=Sulfolobus.
Sequence
MVLPFNSVEAFSVNVSEKHELFRRAVREFMERDVAPYVEKGEKEGTVPKEVLEKAKEIGL
YGVAVPEQYGGQGGDTLMTAIAQEEISRVWASLSTRVSVGGLFITPILLFGNEEQKKKYV
TPVARGDKVAAFANTEPAAGSDVAGIQTIAKKINGKYVINGRKIFITNGGIADYYVVTAR
TSPPEPNARWKGISMFIVEREWKGVKVLNRIETMGLRASNTAELAFEDVEVPAENLLGEE
GNGFKYAMATFDRTRVGVAAQGVGVAQAALERMVTYSTQRFAFQSPLIGFQMVQEKIAES
LTEVNTARLLTYWAASLFDRGLENEAIVAASMAKLYATDIAEKVAIRAITVHGGYGVATS
TGVERLLRDVEVMRIYEGANDIQKLVILRETARRLLGIKM
Download sequence
Identical sequences C3MLF3 C3NKM0 D2PGL4
2013586161 gi|229581023|ref|YP_002839422.1| 419942.YN1551_0323 429572.LS215_2605 gi|284998956|ref|YP_003420724.1| WP_012714438.1.34992 WP_012714438.1.52267 WP_012714438.1.66823 gi|227831420|ref|YP_002833200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]