SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3NL58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NL58
Domain Number 1 Region: 94-117,170-414
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.77e-65
Family D-glucarate dehydratase-like 0.000092
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.98e-20
Family Enolase N-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3NL58
Sequence length 419
Comment (tr|C3NL58|C3NL58_SULIN) Mandelate racemase/muconate lactonizing protein {ECO:0000313|EMBL:ACP47572.1} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_0404 OC=Sulfolobus.
Sequence
MELKITDFKVFVAQANFEWAFVRIYSKDLYGTGEAGPAPGLKGMESEFRQLLIGEDAFKI
NRIVEKLRYAALYSGTTVYHLISAINIALYDIIGKFLNVPIYKLLGGDKTEIPVYVDAHG
GKGLEAINALHLPVNLPWIKEAEVETSRLLTTNNPVHGRLSMEKWNEDYSPEAYAKRALK
MKNEGYKAMKFDLDVPTPYIDLRRVRNGDLSLKDIDYMAEIVKAVRESVGNEVEIMFDLH
WRYNLNTAIRICKSLEPYRLRWLEDPTPAIMAVPNYDELKLLTSQCSVPIETGENLYTVY
QFKDLLNTGTRVWAPDIVKAGGITEGRRIAELAAMYDIEYSPHNIASPIGTMAHAHVGSI
ANTFGFVEFHGHDVPFWNEIVKPKRRIIGDGVIKLTEDPGLGVDLDDEVMRKYWPDYNL
Download sequence
Identical sequences C3MSE2 C3NL58 C4KL80 D2PGD4 F0NCS4 F0NLE7 M9U9F0
gi|229581095|ref|YP_002839494.1| WP_012712299.1.100559 WP_012712299.1.27011 WP_012712299.1.34992 WP_012712299.1.47130 WP_012712299.1.52267 WP_012712299.1.60638 WP_012712299.1.67233 WP_012712299.1.68242 WP_012712299.1.89621 WP_012712299.1.91160 WP_012712299.1.97021 gi|284998876|ref|YP_003420644.1| gi|227828603|ref|YP_002830383.1| gi|238620803|ref|YP_002915629.1| gi|385776944|ref|YP_005649512.1| gi|385774285|ref|YP_005646852.1| 419942.YN1551_0404 426118.M164_2363 427317.M1425_2356 gi|479326594|ref|YP_007866651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]