SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C3Z1K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3Z1K1
Domain Number 1 Region: 629-877
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-55
Family YWTD domain 0.00000322
Further Details:      
 
Domain Number 2 Region: 24-282
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-53
Family YWTD domain 0.00000165
Further Details:      
 
Domain Number 3 Region: 335-578
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-51
Family YWTD domain 0.00000343
Further Details:      
 
Domain Number 4 Region: 947-1200
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-37
Family YWTD domain 0.0000279
Further Details:      
 
Domain Number 5 Region: 1254-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1333-1370
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 286-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 9 Region: 585-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000443
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 1210-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000029
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 890-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000395
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3Z1K1
Sequence length 1626
Comment (tr|C3Z1K1|C3Z1K1_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN53619.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_123121 OC=Branchiostoma.
Sequence
MARAGLLLLGSLCAAFQVALPNPRLLFANRRDVRIIDAGPGRGHNSTVVVSNLEDAAALD
FIYDQNVIYWTDVSLEMIKMIYTNGSGIVTDVISTGLVSPDGLACDWIGRKLYWTDSETN
RIEVSNLDGTSRKVLFWEELDQPRAIALDPARGYMFWTDWGEVPKIERAGMDGTGRRVVV
DDNIYWPNGLTLDYAELRLYWADAKLQLIHYANFDGSERRAVVEGSLPHPFALTLYGDTI
YWTDWQTNSIHSCHKISGEDKQVIHSEIFSPMDIHAYMPARQLMRHTNPCQPNNGGCSHL
CLMSPDAPNYRCACPTGVKLLDDERTCADGASEILLLARRTDLRRISLDTPDYTDVVLQI
DDIRHAIAIDYDVVEGFVYWTDDEARAIRRARLDGSEVEHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILIAENLDEPRAIVLDPSEGYMYWTDWGQHPKIERAELDGSHRVVL
FNTSLVWPNGLAIDYQSRRIYWGDAKTDKIEYANLNGTGRTILVDEKLPHIFGFSLLGNY
IYWTDWQRRSIERVHKTTGEDRQIIVDQLPDLMGLKAVNVQRTDGWNPCVDNNGGCSHLC
LYRPSGVSCGCPMGLELITDMRTCIVPEAFLLFSRRADIRRISLETNNNDVVIPLPGVKE
ASALDFDINDNRIYWTDVSLKSISRAFMNGSSAEKIIQFGLDYPEGMAVDWVAHNLYWAD
TGTNRIEVARLDGSSRKVLVWQDLDNPRSLALDPAFGFMYWSEWGGDPKIERASMDGTNR
FILVDSLGRANGLTIDYPERRLYWADLDTNLIESSNMLGNDRKRVISDNLPHPFGLTQYQ
DYVYWTDWNTRSIERANKTTGENRTRIQGSLDYVMDIMDILVFHSSRQSGWNQCAVNNGG
CSHLCLATAMPSSTSAESAMDLPVMCGCPSHWKLDPDNRTCHPPASFLLFSQRNLISRMV
FDEQQSPDIVLPIHQLRNVKVIDYDRMGEHIYWIDGRIKQLKRAKANGSEVTSVVANLDS
LFYPIDMAIDEFSRHIYWTCSQTNTINVTRISDLSPVGVVVSGDKERPRSIVLDPKRGYM
YWTNMVSNPSIEKAALDGTERQTLFSSDIKQPGPLAIDTKYGKLYWTDIELNRIESSGLD
GANRQVLVEQMIIQLSGLTIFGDHLYWIDRAKQMIERIDKLTGSGRTRIQARLVQLSDIV
GVDSKDITEMNHHPCAIDNGGCSHICIAMKDGRSRCSCPLHLVLFPNELQCGEPPTCAPD
HFTCETGEVDCIPLLWKCDGVAECSDGSDEADCPKCTEDQFTCDSGQCVDGQKVCDGKED
CMDRSDEMQCHSTCAPDQFLCRNGLCIEQEKRCNNEKDCVDNSDEDDCDPKGDLRTYGNE
DSNSLTIAVVISAIMAVLIIFMMVFVWRKLKRQQEDGFTNDIVMVTNGNVPTMVALPPSA
GTNSLPRSVSGLSTSRGKSATTCLSSSSVPGSGCGPPLYDRTHVTGASSSSTGSLGTHYP
HETLNPPPSPATDRSQYTADLFYSSRSSQSPSTVRSYKHYKFRNVPPPPTPCTTDGCEDS
EPYPLRGLRPKYYDMNYDSDPYPPPPTPRSHYMSDNNCDSCPPSPSTARSYFHPYVPPPS
PATDSP
Download sequence
Identical sequences C3Z1K1
XP_002597607.1.56174 7739.JGI123121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]