SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4JM67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4JM67
Domain Number 1 Region: 36-81,124-311,344-561
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.21e-56
Family AAT-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4JM67
Sequence length 597
Comment (tr|C4JM67|C4JM67_UNCRE) Uncharacterized protein {ECO:0000313|EMBL:EEP79079.1} KW=Complete proteome; Reference proteome OX=336963 OS=Uncinocarpus reesii (strain UAMH 1704). GN=UREG_03925 OC=Eurotiomycetidae; Onygenales; Onygenaceae; Uncinocarpus.
Sequence
MAPMPTEPPLPGSHDSDDLNRRRTAEPMLRPPHDFSRYYSCATRRRVASSVKDFYKYFAI
PGIHNLAGGLPHVSYFPFDSLEATVALPNRIPKDGFVPQPQPTASPASPPASQRVVVPKE
SSVDDGLRRIDLATALQYGAVDGYPPLRSFIRQFVRENLHPHVPYEGGPEVILTCGATDG
FSKTIEAFTNVWDENRDWIRERQGLLCEEFAYMTAIQTARPRGLNIVPVAVDSQGMKVEG
ERGLADVLDNWDFSRGQRPHLMYTVTIGQNPTGAVLPLERRRQIYKLCQRYDIIIIEDDP
YWHLQYPSAKQNALRQGQSDSSPHTPFSVHDEPSGFPFLDSLVKSYLSIDTAGRVVRLDT
FSKIIAPGCRLGWLTAQPDIVERILRISETSTQQPSGFVQSMVAKLIMGDQADDMVKKPC
TEGSPGWRVDGWVRWLEGLRGGYEKRMQTMCTILEEGRFSIVQGDALSNDSNLDEWQVVD
NVQMFDFDWPGAGMFVWVKFCLETHPLWSQVPAAKLANALWKYLINAPYRVIVGPGWLFA
PTEDVKKYAWRYMRLCFAPVDEGAVATSSHNFIEGCRSFWQVKDIHDIDDLEDDNEE
Download sequence
Identical sequences C4JM67
URET_03925 XP_002544408.1.76999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]