SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4JNB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4JNB5
Domain Number 1 Region: 152-548
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.97e-105
Family GABA-aminotransferase-like 0.0000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4JNB5
Sequence length 631
Comment (tr|C4JNB5|C4JNB5_UNCRE) Delta-aminolevulinate synthase {ECO:0000256|RuleBase:RU910713} KW=Complete proteome; Reference proteome OX=336963 OS=Uncinocarpus reesii (strain UAMH 1704). GN=UREG_04321 OC=Eurotiomycetidae; Onygenales; Onygenaceae; Uncinocarpus.
Sequence
MEALLHQSRSLCPFLKRTSPSTLRSLSSSTRPQAAASPGGGTISNLQVIARRCPIMSKAL
AVQSARMAGAGGCPMKGLRGLHTSAVRQASVREVGGKKADRVPPALSNLSSIPSPSAAMK
RDTVCPGPKPAAPPAGKFDYEGFYSGELEKKHKDKTYRYFNNINRLAREFPQAHMSSPGD
KVTVWCANDYLGMGRNPYVLQSMHETLDSYGAGAGGTRNISGHNQHAVRLEDTLAKLHRK
EAALVFSSCYVANDATLATLGSKLPDCVILSDSLNHASMIQGIRHSGAKKMVFKHNDLAD
LESKLASLPPSTPKIIAFESVYSMCGSIAPIEEICDLADKYGAITFLDEVHAVGMYGPHG
AGVAEHLDYDIHATSPENVKGTVMDRIDIITGTLGKAYGCVGGYIAGSAKFVDTIRSLAP
GFIFTTSLPPATMAGATTSIKYQAGYGRDRTLQQLHTRAVKSALNENDIPVIPNPSHIIP
ILVGDAELAKRASDMLLEDHGIYVQAINYPTVPRGEERLRVTPTPGHTKPLRDHLVASLQ
QVWERLGIRKTSDWKAAGGFLGVGDDAAAHDVKNQPMWTDEQVGLNKGEDIEVALQRELK
AEAVARQCILNELAEPTRMAAATAQPVSVAA
Download sequence
Identical sequences C4JNB5
XP_002544804.1.76999 URET_04321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]