SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4JRD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4JRD2
Domain Number 1 Region: 284-553,604-651
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.61e-84
Family IF2B-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4JRD2
Sequence length 663
Comment (tr|C4JRD2|C4JRD2_UNCRE) Uncharacterized protein {ECO:0000313|EMBL:EEP80179.1} KW=Complete proteome; Reference proteome OX=336963 OS=Uncinocarpus reesii (strain UAMH 1704). GN=UREG_05021 OC=Eurotiomycetidae; Onygenales; Onygenaceae; Uncinocarpus.
Sequence
MEDSARQKKGFGKVVVALSRRCLRWPKRRLMVLVRRRKKSQVTRSSGEHQLVSANNTSHH
DHHDANGNALEHGLLSSTDTIMSVAKQKIINSAQGGAEEGPGSQLLSGGESSAAKGDESS
ANASAAMNGGAENKNRKKQEAKGGPEAKQGAEKKDSQQQQQQQQGEGPPKLSNAELKKRA
KAEKAARRAKEKQEREGEQAASAQLQNQQQQAKKGGGGGGGAGKQKQGAPAAGTKQAAQR
RGSVHVPAVESKKKKKSENENIVAVFGHLPWHSRRAGIAGVGKEIHPAVVALGMQLRDYV
ICGSSARCVATLLALRRVVQAYITPIGTSLSRHLTTYLSHQINYLTTCRPLSISQGNAIR
ALKLEITTIDPGDSEDEAKQQIYDYIDNYIREKYTVASQVIANSAADRIKDGDVILCYAG
SSVVQKALLTAHAQGKKFRVSIIDTRPLFEGRNFARTLSKAGLEVQYSLINGITTAIRDV
TKVFLGAHAMTSNGCLFSRVGTALVAMSAKERVGGINIPVIVCCETAKFTDRVALDSIVV
NEIADADELVAVEAPEQVTNLSPPTPAPTGKGGKAASTASSATNADTGSIASSLGPTSLV
TDPSQPLQNWREMKNLQLLNIMHDVTPAQYIDMVITEMGSLPPSAVPIVHRMSTESEEKD
AKH
Download sequence
Identical sequences C4JRD2
XP_002584332.1.76999 URET_05021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]