SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4LW35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4LW35
Domain Number 1 Region: 60-110
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000293
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 
Domain Number 2 Region: 9-57
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000523
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4LW35
Sequence length 164
Comment (tr|C4LW35|C4LW35_ENTHI) Zinc finger protein containing CCHC type domain {ECO:0000313|EMBL:EAL49254.1} KW=Complete proteome; Reference proteome OX=5759 OS=Entamoeba histolytica. GN=EHI_141890 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSEHKSHYNHDKDKICFYCRQPGHCLKNCPKKAKGEDSICYNCGSHDHILRDCPEPRTGK
LAFSTCFVCHQMGHISRDCPNNPKGIYPQGGGCRYCGDVNHFAKDCPNKRKKQTGDDDQD
DYVSKRDIEEKGFKSGDGDEEKPIKPTKSEQDEVPKKKKKVIKF
Download sequence
Identical sequences A0A175JH16 C4LW35 M2RSS0 M3TSB5 M7W991 N9UHV9
294381.C4LW35 gi|56471707|gb|EAL49254.1| gi|67478497|ref|XP_654640.1| jCVI|EHI_141890 XP_654640.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]