SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4XK84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4XK84
Domain Number 1 Region: 178-564
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.44e-87
Family beta-Lactamase/D-ala carboxypeptidase 0.0000878
Further Details:      
 
Domain Number 2 Region: 66-228
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.19e-36
Family Penicillin binding protein dimerisation domain 0.0011
Further Details:      
 
Domain Number 3 Region: 619-665
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4XK84
Sequence length 678
Comment (tr|C4XK84|C4XK84_DESMR) Peptidoglycan synthetase FtsI {ECO:0000313|EMBL:BAH76824.1} KW=Complete proteome; Reference proteome OX=573370 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1). GN=DMR_33330 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MRRTPKDQRQHATVRDWSRVKLTCVGVFFALAWLALWSRAGYLQIVAGPELAQQAVRQHV
ASEVDKGARGEIYDRTGRLLAKSVEIEALFVRPKEIVDIDKTAAFLAKVLHMKEQRVKKK
LQSPSSMAYLSWRVGDRTAAKIREAALPGVYFTKEFGRFYPNGHLASQVMGFVGVGDVGL
EGMEKSFDTRLTGRQAKYVVQRDASGRRFFFDSQGRELADINGHDVRLTIDSQIQFFAEE
ELEKAVVNNNAKSGTCLVVHVPTGDILAMANYPFFNPNVGRGISPRVARNHAALDVWEPG
STMKPLLVAAALQERTVKPTSTFNCENGKFGLAGKVIKDTHSYGVLPVNMILRVSSNIGA
AKIGLQLGSPRLHAYFEKLGFGRPTGLPISGEGKGLLRPLKNWSVLDLATCSFGQGVAVT
PVQMAQAFLILANDGVYKPLRLVADPDEANPQRQPYRVFDADVARTVQRMMREVVHEEHG
TGRNALIPGLEIGGKTGTAQKAAAHGGYGNKYLGSFVSFVPAVGPEYIVMVLVDEPEPSH
YGGVVAAPAVKDVTLRMLSYLGRMPETVQLAKAPAAASAETPAAPAAAAASGGPSRADQE
ILAIAQSKPATAKAVEVHAVPDFSGMPLRRAVEILAQKGIVPKLEGQGLVVNKQSPAPGA
PWPGDKPSEFVLWLSRPS
Download sequence
Identical sequences C4XK84
573370.DMR_33330 gi|239907969|ref|YP_002954710.1| WP_015861974.1.87776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]