SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4Y8B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Y8B6
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.91e-32
Family Ribosomal protein S13 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4Y8B6
Sequence length 117
Comment (tr|C4Y8B6|C4Y8B6_CLAL4) 40S ribosomal protein S18 {ECO:0000313|EMBL:EEQ40316.1} KW=Complete proteome; Reference proteome OX=306902 OS=lusitaniae). GN=CLUG_04444 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora.
Sequence
MYALTKIRGVGRRYSNLVCKKADVDLNKRAGELTQEELERVVTIMQNPTQYKIPAWFLNR
QKDHVDGKDYHVLANNLESKLRDDLERLKKIRAHRGIRHFWGLKVRGQHTKTTSRGR
Download sequence
Identical sequences C4Y8B6
XP_002615562.1.3285 CLUT_04444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]