SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4YBA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YBA4
Domain Number 1 Region: 189-278
Classification Level Classification E-value
Superfamily S13-like H2TH domain 9.71e-19
Family Middle domain of MutM-like DNA repair proteins 0.0047
Further Details:      
 
Domain Number 2 Region: 3-16,51-111
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000108
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Weak hits

Sequence:  C4YBA4
Domain Number - Region: 122-157
Classification Level Classification E-value
Superfamily Gam-like 0.0942
Family Gam-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4YBA4
Sequence length 346
Comment (tr|C4YBA4|C4YBA4_CLAL4) Uncharacterized protein {ECO:0000313|EMBL:EEQ41354.1} KW=Complete proteome; Reference proteome OX=306902 OS=lusitaniae). GN=CLUG_05482 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora.
Sequence
MAVLMHFGMTGMIHLRDVKSHLVFMENGGDKKIKSEKENGDETPELESEPEPQEWPPRFS
KFELELENGQKTELAFVDPRRLARVRLLWGPECSSDELLMQQEPLKRQGPDYSKGGEREV
KKEEGEVKREVKKEEGEVKEEVNKIKEEAEGEEGLAKAEQDVISLFSPSHEPSVSDFPRP
TVFHPDPDPDPHGRARLAFPDFAKLVLSRRKPIKALLLDQAFFAGVGNWVSDEILYHAQI
HPSENLAEHISDPEDPRLARLYYSLIYVMEVSVAVEGNVREFPENWLMLHRWGKRRKEKA
KTKMGYSVAFETVGGRTSCFVPELQKRMGPAVKRRKTSKEKQSDDE
Download sequence
Identical sequences C4YBA4
XP_002614704.1.3285 CLUT_05482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]