SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4YC37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YC37
Domain Number 1 Region: 6-390
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.93e-94
Family IF2B-like 0.0000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4YC37
Sequence length 402
Comment (sp|C4YC37|MTNA_CLAL4) Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein {ECO:0000255|HAMAP-Rule:MF_03119} KW=Complete proteome; Reference proteome OX=306902 OS=lusitaniae). GN=MRI1 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora.
Sequence
MSKDTLEAIRFDKENVTLDILDQLLLPYESRYINIKSIQDAFEAIKSMQVRGAPAIAIVG
AFAITVDTHLYLKSGETSKTVADLLNSIDYLVTSRPTAVNLANACNEIKALLVSHFEKSD
LVTEKVWKLLFDYSVSLHEDDLRNNFKIGENGLRFISETLKAQNFKGPFSIVTVCNTGSL
ATSGHGTALGVIRTVHAQLSKSVSNEEFWFEHVYPLETRPYNQGAKLTTYELHYEKIPFT
MICDNMVTSLISTLHKKKNIKGSAAPVKFIITGADRVVKNGDSANKIGTYQLAAIADFFN
STFTKEEDKIKFMVAAPNTTIDLKTETGDEIVIEERPAHELTSLKGPVLREDGSVGEKMT
VGIATPGIQVWNPAFDVAPYQLIDCIVTEDEPFKKVDGKFSF
Download sequence
Identical sequences C4YC37
XP_002614368.1.3285 CLUT_05854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]